PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010930821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 311aa    MW: 35944.2 Da    PI: 5.8083
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010930821.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.14.2e-5481352128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     ppGfrFhPt+eelv +yL++kv+++k++l evi+++d+y++ePwdL+      ++e+kewyfFs++dkky++g+r+nrat++g+Wkatg+dk+v+
  XP_010930821.1   8 PPGFRFHPTEEELVGYYLARKVSSQKIDL-EVITDIDLYRIEPWDLQDrcnLGHEEQKEWYFFSHKDKKYPSGTRTNRATSTGFWKATGRDKAVT 101
                     9****************************.99**************952432334667************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s k + +g++ktLvfy+grap+g+ktdW+mheyrl
  XP_010930821.1 102 S-KCNIIGMRKTLVFYEGRAPNGRKTDWIMHEYRL 135
                     *.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-605156IPR003441NAC domain
PROSITE profilePS5100558.637156IPR003441NAC domain
PfamPF023651.2E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEVESCIPPG FRFHPTEEEL VGYYLARKVS SQKIDLEVIT DIDLYRIEPW DLQDRCNLGH  60
EEQKEWYFFS HKDKKYPSGT RTNRATSTGF WKATGRDKAV TSKCNIIGMR KTLVFYEGRA  120
PNGRKTDWIM HEYRLQSSEN GPPQEEGWVV CRAFKKQNTS QRQCFNTYNP QYCIRDHDCY  180
GLEALSDACM TTRLANSIAA QTFHEQSFRC EMELGFRQAH LNHVLEIPSL DSPSLSTNLA  240
VKEIFEPSIV ANEDHSAQRN DFRGQFIDWK ALDKLLASQL NESFASSNSN VPLIPLDYDI  300
DAQNQDHFLS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-55716217171NAC domain-containing protein 19
4dul_A5e-55716217171NAC domain-containing protein 19
1ut7_B5e-55716217171NO APICAL MERISTEM PROTEIN
1ut7_A5e-55716217171NO APICAL MERISTEM PROTEIN
1ut4_B5e-55716217171NO APICAL MERISTEM PROTEIN
1ut4_A5e-55716217171NO APICAL MERISTEM PROTEIN
3swp_D5e-55716220174NAC domain-containing protein 19
3swp_C5e-55716220174NAC domain-containing protein 19
3swp_B5e-55716220174NAC domain-containing protein 19
3swp_A5e-55716220174NAC domain-containing protein 19
3swm_D5e-55716220174NAC domain-containing protein 19
3swm_C5e-55716220174NAC domain-containing protein 19
3swm_B5e-55716220174NAC domain-containing protein 19
3swm_A5e-55716220174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930821.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-103NAC37_ARATH; NAC domain-containing protein 37
TrEMBLD7SR911e-126D7SR91_VITVI; Putative uncharacterized protein
STRINGVIT_18s0072g01060.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25943791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-104vascular related NAC-domain protein 1